SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010830 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010830
Domain Number 1 Region: 622-877
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 11-271
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-54
Family YWTD domain 0.00000161
Further Details:      
 
Domain Number 3 Region: 322-551
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-50
Family YWTD domain 0.00000356
Further Details:      
 
Domain Number 4 Region: 924-1181
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-37
Family YWTD domain 0.0000699
Further Details:      
 
Domain Number 5 Region: 1312-1348
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1274-1310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1234-1272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 577-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000186
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 277-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000661
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 880-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1191-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010830   Gene: ENSPANG00000023602   Transcript: ENSPANT00000016275
Sequence length 1592
Comment pep:known chromosome:PapAnu2.0:14:5899201:6005442:-1 gene:ENSPANG00000023602 transcript:ENSPANT00000016275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDV
SEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSR
KVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTI
DLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHA
CNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPREPFYTCA
CPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQWMTSGHAIAIDYDP
LEGYVYWTDDEVRIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVT
RLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLG
WPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDW
QRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHAT
RCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFD
VSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIE
VARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV
GRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDW
NLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGG
HRCGCASHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAID
YDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCE
ATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTER
EVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTVL
GKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGG
CSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGF
PECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRC
ASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGV
YFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSL
MGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPA
TARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQY
LSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSPANP00000010830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]