SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011576 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011576
Domain Number 1 Region: 182-427
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-36
Family Voltage-gated potassium channels 0.0065
Further Details:      
 
Domain Number 2 Region: 428-542
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000131
Family cAMP-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011576   Gene: ENSPANG00000015022   Transcript: ENSPANT00000016680
Sequence length 621
Comment pep:known_by_projection chromosome:PapAnu2.0:13:89724377:89751338:1 gene:ENSPANG00000015022 transcript:ENSPANT00000016680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKINTQYSHSSRTHLRVKPSDRDLDRAENGLSRAHSPGEETSSALQPGIAMETRGLAES
GQGSFTGQELARLSRLICWLRRRAVRHVHHHDQGPHPFPDRSRGAELKEVSSQESNTQAN
VGSQEPADRGRSAWPLAKRNTNTSNNTEEEEHRFKRVEERNQRDPKGTPGKKTKKKDAIV
VDPSSNLYYRWLTAIALPVFYNWCLLICRACFDELQSEYLMLWLLLDYSADVLYALDALV
RARTGFLEQGLMVSDTNRLWQHYKTTMQFKLDVLSLVPTDLAYLKVGMNYPELRFNRLLK
FSRLFEFFDRTETRTNYPNIFRIGNLVLYILVIIHWNACIYFAISKFIGFGTDSWVYPNI
SIPEHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVG
SMISNMNASRAEFQAKIDSIKQYMQFRKVTDLETRVIRWFDYLWANKKTVDEKTQFVVLS
DGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKG
RQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRL
SQLESQVKGGGDNPLADGEVP
Download sequence
Identical sequences ENSPANP00000011576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]