SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011881 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011881
Domain Number 1 Region: 897-995
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000055
Family cAMP-binding domain 0.015
Further Details:      
 
Domain Number 2 Region: 615-730
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000337
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011881   Gene: ENSPANG00000000577   Transcript: ENSPANT00000004035
Sequence length 1178
Comment pep:known_by_projection chromosome:PapAnu2.0:2:31770166:31887459:-1 gene:ENSPANG00000000577 transcript:ENSPANT00000004035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEYLRSLLFSAPDDLPEIILTLSLISTIGAFLNLHLKDFPIPLPVMLFLLGCGFEVLSFT
SLRVQRYANAIQWMSPDLLFCIFAPVIFFTTAFDMDTYMLQKLFWQILLITIPGFLVNYI
LVLWYLAAVNKLHLKPTPWLLFSAILVSSDPMLTAAAVRDLGLSRSLISLINGESLMTSV
ISLIIFTSIMDFDKGLQSRRNHTIARYIVGEFFSNIIASFLFGILSSKLIQFWMSTVFGD
DVNHISLIFSILYLIFYICKIGELLGMSGIFTLAIVGLLLNSTSFKAGVEALLLEFWNFL
SRVAFLMVFTFFGLLIPAHTYLYVKFADIYYSLNIYFTLIVLRLVTLLLMSPALSRVGHE
FSWRWVFIMIWSETKGMPNINMALLLAYSDLYFGSDKEKSQILFHGVLVCLITLIVNRFV
LPTAVTILGLRDATSTKYKSVCCTFQHFQELTKSVASVLKFDKDLANADWNMIEKAIILE
NPYMLNQEETTEQQKVKCPHCNKEIDEILNIEAMELANRRLLSAQMASYQRQYRNEVLSQ
SAVQVLVGAAGSFGEKKGKCMRLETIKNYSESQKTITFTRKLLLNWVYNTRKEKVGPSKY
FFFHLCHTIVFTEEFEHVGYLVILMNIFPFVISWISRLNVIYRRELKHTNYCFLTLYVLE
ALLKIAAMRKDFFSHTWNLFELAITLTGILYAILTEIEAIKYIFAVTEVIVFIKLVQFIR
ILRIFKLIAPKVLQIIDKRVSHQKTFWYGILKGYVQGEADVMTIIDQITSSKQIKQILLK
RVIRNMKHATKELGYLEYDHPEIAVTVKTKEEINVMLNMAGEILKAFGLKGIIHKIESAQ
ISKLITAKKKEMLESKSIIRPLTVEEVLYHIPWLDKNQDHINFIQDKIKIVLNNMQNEGD
EPQGIYIIISGMVKLERSKPGLGIDQMVESNEKDFLIIDTDYMLSGEIIGEINCLTNEPM
KYSATCETVVETCFIPKTHLYDAFKQCSPLIEHKMWLKIGLAITARKIREHLSYEDWNYK
MQLKLSNIYIEDIPMTTKTDIYDENVIYVILIHGAVEDCQLRKFYRAPFLIPITCHQIQG
IEDFTKVVIIQTPTNMKAFRWNIRKFIPKHKSSLTPGLMPGSTETLEAGIQEETKTNVKE
DGAHSTATARSPQPCSLLLTKFNCKKSLRINLGKSGKP
Download sequence
Identical sequences ENSPANP00000011881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]