SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014083 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014083
Domain Number 1 Region: 9-498
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-156
Family ALDH-like 0.000000000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014083   Gene: ENSPANG00000017222   Transcript: ENSPANT00000015240
Sequence length 503
Comment pep:known_by_projection chromosome:PapAnu2.0:7:32139222:32244489:-1 gene:ENSPANG00000017222 transcript:ENSPANT00000015240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDK
AVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVD
LQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAP
ALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKI
AFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADCKSTTGPTHEPAHTLWMTA
HVGQCKIERMNMEELYDFTQVHVNLEASSKNLIGIPLKTNHNKIGPQIDKKQYNKILELI
QSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVI
ERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREM
GEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSPANP00000014083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]