SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014390 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014390
Domain Number 1 Region: 1975-2210
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-55
Family DBL homology domain (DH-domain) 0.0000403
Further Details:      
 
Domain Number 2 Region: 2210-2334
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-31
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 1780-1845
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000822
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014390
Domain Number - Region: 153-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000586
Family Ankyrin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014390   Gene: ENSPANG00000005909   Transcript: ENSPANT00000017715
Sequence length 2803
Comment pep:known_by_projection chromosome:PapAnu2.0:7:59967547:60182646:1 gene:ENSPANG00000005909 transcript:ENSPANT00000017715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FALSPFQASLLLENVWTCLLAEEDKVEDDVVFYLVFSGSTLRHCTSTRKVSSDTLETIAP
GHDCCETVKVQLCASKEGLPVFVVAEEDFHFIQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKVVLAFRHLKLPAEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESESHEHPFPGDSCTGHIFRLMNIQQQLMKTNLKQMDNLMPLM
VTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEEMESTHCCPGIPVTQTESPCDLSSIVE
EENTDHSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQRLPDCGVKGMEGVSSCGNR
SEETGTKSSRMPTDQDSLSSGDAVLQRDLVMEPGTAQYSSGGELGDISTTNVSTPETAGE
MEHGLMNPDATVQKNVLEVGESTKERFENSNIGTAGASDVHVISKPVDKVSVPNCAPAAS
SLDGDKPAESSLAFSNEETSIEKTAETETSQSREDSADAPVDQNSVVIPAATEDKISDGL
EPCTLLAAVIGEAMSPSDLALLGLEEDVMPHQNSETNSSHAQSQKGKSSPICSTTGDDKL
CADSACQQNTVTSSGDLVAKRCDNIVSQPESTTARQPSSQDPPNATHCEDPQANTVTSDP
VRDTRERVDFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVIS
DSTFFLANNPGSESVTKDDALSFVPSQKEKGTATPELHMATDCRDGPDGDSNEPDTQPLE
DRAADLSTSSTAAELQRGMGNTSLTGLGGEREGPAPPAIPEALNIKGDTDSSLQSVGEAT
LALDSVLTEEGKLLVVSESSATQKQDKDIAVTCSSIKENALSSGMLQEEQRTPPPRQETL
QFHEKSVSVDGAKDKALQLSNSPGAPSACLKAETEHNKEVAPQVSLLIQGGAAQSLVPPG
ASLATDLRQEALGAEHNSSTLLPCLLPDGSDGSEALNCSQPSPLDVGVKNTQSQGKTSAC
EVNGNVTVDVTQVNALQGMAVPRRKNVSHNTQDILIPDVLLNQEKNVILGLPVALRDKAV
TDPQGVGTPEMVPLDWEKGKLEGADHSYTRGDAEEAQIDAEAHPVLLQPAAKELPTDMGL
SSHDDEAPAGAREVLQALPSGRERSTPSLPCMVSAQATPLPKGADLIEEAASRIVDAVIE
QVKTAGALLTEGEACQMSLSRPKLGPLTEGLENAFTEKVSTFPPGESLPMGSTPEEATGS
LAGCFAEREEPEKIILPVQGPEPATEMPDVKAEDEVDFRASSVSEEVAVGSIAATLKMKQ
GPMTQTINRENWCTIEPCPDAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSDS
DLFHSPSDDMDSIIFPKPEEEQLTCDITGSSSSTDDTASLDQHSSHGSDVSLSQILKPNR
SRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSPF
RRHSWGPGKNAASDAEMNHRSSMRALGDVVRRPPIHRRSFSLEGLTGGAGVGNKPSSSLE
VSSANAKELRHPFGGEERVDSLVSLSEEDLESGQREHRMFDQQICHRSKQQGFNYCTSAI
SSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANQTESITEENYNFPPQSLFKKDSEWKS
ATKVSRTFSYIKNKMSSSKKSKENNKKNNKKNVFSKEREMKVKEKLKKTVNGHTFSSIPV
VGPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLP
TVIMRNKPAQPKERPRSAVLLVDETTTTPIFASRRSQQSVSLSKSVSIQNITGVGNDENM
SNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIDSKQLEAESWSRI
IDSKFLKQQKKDVVKRQEVIYELMQTELHHVRTLKIMSDVYSRGMMTDLLFEQQMVEKLF
PCLDELISIHSQFFQRILERKEESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGK
FCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQR
ILQCTKDNEVEQEDLAQSLSLVKDVIGAIDSKVASYEKKVRLNEIYTKTDSKSIMRMKSG
QMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKST
VISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWIQIIQDTINTLNRDE
DEGIPSENEEEKKMLDTKARELKEQLQQKDQQILLLLEEKEMIFRDMAECSTPLPEDCSP
THSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQEGAVGP
VSLPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNS
EQVVQSIVHLHELLSTLQGVVLQQDSYIEDQKLVLSERALTRTLSRPSSLIEQEKQRSLE
KQRQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEKVQQGQQDLEKERE
ELQQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHSKLMRIP
SFFPSPEEPPSPSAPSIAKSGSLDSDLSVSPKRNSISRTHKDKGPFHILSSTSQTNKGPE
GQSQAPVSTSASTRLFGLAKTSRSQPGDGPTSEVSAEGEEIFC
Download sequence
Identical sequences ENSPANP00000014390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]