SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014497 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014497
Domain Number 1 Region: 213-306
Classification Level Classification E-value
Superfamily TAFH domain-like 4.45e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 500-547
Classification Level Classification E-value
Superfamily Histone-fold 2.64e-17
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014497   Gene: ENSPANG00000022570   Transcript: ENSPANT00000026422
Sequence length 713
Comment pep:known_by_projection chromosome:PapAnu2.0:10:2262184:2348656:1 gene:ENSPANG00000022570 transcript:ENSPANT00000026422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLPRTPTATTSGIRATLTPTVL
APRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRP
ATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVL
GGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQ
STETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSA
AFIQQSQQQPPPPASQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGV
GKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVP
VVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARI
LATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQN
LVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKS
RSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGS
GPGSVVPGSSGVGAPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSPANP00000014497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]