SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014720 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014720
Domain Number 1 Region: 565-774
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-46
Family DBL homology domain (DH-domain) 0.00056
Further Details:      
 
Domain Number 2 Region: 796-905
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 68-148
Classification Level Classification E-value
Superfamily F-box domain 1.31e-17
Family F-box domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014720   Gene: ENSPANG00000015852   Transcript: ENSPANT00000018717
Sequence length 907
Comment pep:known_by_projection chromosome:PapAnu2.0:4:123586511:123677542:-1 gene:ENSPANG00000015852 transcript:ENSPANT00000018717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLFAIFLRCTKSQLR
FVQDWFSERMQVAKVDFSTVLPRFISLYIFSFLSPKDLCAAAQVSWPWKFLTEQDCLWMP
KCVKFGWFLPYTPTDNEYGAWKRHYVACVSHLDWLTPREAAATYGTLNEPKTEDEELLER
QREECLRKRIWEEIALRNKELFKVRPPWVSGTCCSSVLKPRRQPRLSQTVRERVGSHEAL
EKQLVLTSLEILPKRSNISGSHSYPLLSKKYRHGVHKNDDSSSYALRPHFILISSRIPAY
EMVVESVKAGVVSVVYEHSVTLESLLYLIEKALDGRKAQSMGIFSDGDSREINLLQGYKI
GVKNLLRPKVRDFWEKLGSYVATEEEGGHVDFFVPLGASDYAEAGTEVLSQLSQLTGTFF
TAPTGIATGSYQHILSDWLGSQWGKAPYAIYFCEAKLQTWSSFADFLEETLKTVRKQLYP
LFKELQKSISGRMIGQFMFDTMGMTNILNNQETAQALADRLMELSKEDSERSVVEDNSWD
TKSRLSKNDLNFEALINLERILQKDSAEKRTRVVRELLQSERKYVQMLEIVRDVYFTPLK
AALSSNRAILSAANIQILFSDILQILSLNRQFLDNLRDRLQEWGPAHCVGEIVTKFGSQL
NTYTNFFNNYPVILKTIEKCREMIPAFRTFLKRHDKTIVTKMLSLPELLLYPSRRFEEYL
NLLYAVRLHTPAEHVDRGDLTTAIDQIKKYKSYIDQMKQNINMKDHLSDIQRIIWGCPTL
SEVNRYLIRVQDVAQLHCCDEEISFSLRLYEHIHDLSLFLFNDALLVSSRGTSHTPFERT
SKTTYQFIASVALHRLLIENIPDSKYVKNAFILQGPKYKWICATEVEDEKFLWLSVLRNA
IKSSMEK
Download sequence
Identical sequences ENSPANP00000014720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]