SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015242 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015242
Domain Number 1 Region: 597-781
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-53
Family DBL homology domain (DH-domain) 0.000000193
Further Details:      
 
Domain Number 2 Region: 789-918
Classification Level Classification E-value
Superfamily PH domain-like 4.84e-35
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 
Domain Number 3 Region: 267-408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000419
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 4 Region: 64-173
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000183
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015242   Gene: ENSPANG00000013628   Transcript: ENSPANT00000018095
Sequence length 1028
Comment pep:known_by_projection chromosome:PapAnu2.0:X:127816755:127884341:-1 gene:ENSPANG00000013628 transcript:ENSPANT00000018095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVISSIFLFVVETDLLLRIKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEE
VIAKVLTYLTSIARQNGPDSQFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPT
SFLQRTFTDIGFRFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWII
FRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVT
KEGKILLTNLEVPDTEGAVSSRLECHQQISGDWQTINKLLTQVHDMETAFDGFWEKHQLK
MEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKRLENLDENSQELLS
KAQFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQ
ARQCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILS
PELKVQMKTIQLKLENIRSIFENQQAGFRNLVHKHVRPIQFVVPTPENLITSRTPFFSSK
QVGVGYSFFQACKLFSKGKKTWRQNQSNLKIEVVHDCQEKRSSGQSSSLDNGNSLDVLKN
HVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDVLFGNMAEIYEFHN
DIFLSSLENCAHAPESVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRK
LKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKEALDAMLDLLKSVNDSMH
QIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCK
RRVESGEGSDRYPSYSFKHCWKMDEVGFTEYVKGDNRKFEIWYGEKEEVYIVQAPNVDVK
MTWLKEIRNILLKQQELLTVKKRKQQDQLTEQDKIQISLQQNDEKQQGAFISTEETESEH
TSTVVEVCEAIASVQAEASTVWTEASQSAEISEEPEEWSSNYFYPTYDENEEENRPLMRP
MSEMALLY
Download sequence
Identical sequences A0A096NQE7
ENSPANP00000015242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]