SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015364 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015364
Domain Number 1 Region: 256-476
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-54
Family DBL homology domain (DH-domain) 0.000078
Further Details:      
 
Domain Number 2 Region: 467-604
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 602-676
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015364   Gene: ENSPANG00000019494   Transcript: ENSPANT00000007904
Sequence length 712
Comment pep:known_by_projection chromosome:PapAnu2.0:12:94701721:94839193:-1 gene:ENSPANG00000019494 transcript:ENSPANT00000007904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKESEDLEKTQRKSRVISASDQQNIDNEPVEVKPELLPEKETSQADQDIQDKEPHSHS
PIKRNSIFNRSIRRRSKAKARDTPERNASCLADSQDNGKSVNESLTLNVPRSRMPPWRTA
VQTGPGAQKMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGL
LYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTPEEEEEEEEEEPASPPERKALPQ
ICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSH
FMENERMRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAAD
HFSVYITYVSNQTYQERAYKQLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITR
LKLLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMICIQKKMEFKI
KSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQ
VFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAP
NRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQ
ERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences A0A096NQQ2
ENSPANP00000015364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]