SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015474 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015474
Domain Number 1 Region: 733-908
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-41
Family DBL homology domain (DH-domain) 0.0000935
Further Details:      
 
Domain Number 2 Region: 918-1033
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-34
Family Pleckstrin-homology domain (PH domain) 0.00096
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015474
Domain Number - Region: 185-327
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000119
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015474   Gene: ENSPANG00000026235   Transcript: ENSPANT00000009665
Sequence length 1192
Comment pep:known_by_projection chromosome:PapAnu2.0:20:49482170:49491618:1 gene:ENSPANG00000026235 transcript:ENSPANT00000009665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPLEDGDESPDSQGHVTDWRFAVCSFRDAWEEEEPASQMHVKDPGPPRPPTGAAQDEG
LQGSPLSRKLQLLLAADESGDPQRDKVESSSVLSEGPGPSGVESLLCPMFSHLNLAQGEG
DTPGVGLVVDPGPSRVMPSGLSPGGLDSNPVGLGDPLSEKSSKLLEAAPSGSSLPKPADC
LLAQDLCWELLASGMATLPGTRDVQGRAVLLLCAHSPAWLQPECSSQELIRLLLYLRSIP
RPEVQALGLTVLVDARICSPSSLSLSSGSLQEAAPGAVYQVLLVGSTLLKEVPSGLQLEQ
LPSQSLLTHIPTAGLPTSLGGGLPYCHRAWLDFRRRLEALLQNCQAACALLQGAIESVKA
VPQPMESGEVGQLLQQTEVLMQQVLDSPRLAWLQCQGGRELTWLKQEVPEVTLSPDYRTA
MDKADELYDRVDGLLHQLTLQSNQRIQALELVQTLEAQEGGLHQIEVWLQQVGWPALEEP
GEPSLDMLLQAQGSFRELYEVAQEQVRQGEKFLQPLTGWEAAELGPPGARFLTLRAQLTE
FSRALAQRCQRLADAERLFQLFREASMWAEEGQRVLAELEQERPGVVLQQLQLHWTRHPD
LPPAHFRKMWALATGLGSEAIRQECRWAWARCQDTWLALDQKLEASLKLPPVGSTASLCV
SQVPTAPAHPPLRKAYSFDRNLGQSLSEPARHRHHAATIAACCRPEAGGGAPPQASPTVP
PPGSSDPRSPNRLQLVLAEMVATEREYVRALEYTMENYFPELDRPDVPQGLRGQRAHLFG
NLEKLRDFHCHFFLRELEACTRHPPRVAYAFLRHRVQFGMYALYSKNKPRSDALMSSYGH
TFFKDKQQALGDHLDLASYLLKPIQRMGKYALLLQELARACGGPTQELSALREAQSLVHF
QLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFVVRTGRHKSVRRIFLFEELLLFSKPRH
GPTGVDTFAYKRSFKMADLGLTECCGDSNLRFEIWFRRRKARDTFVLQASSLAIKQAWTA
DISRLLWRQAVHNKEVRMAEMVSMGVGNKAFRDIAPSEEAINDRTINCVLKCREVRSRAS
IAVAPLDYDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLHCPRYPRNFLEEAAL
ETEAELGSQPSLTPEDSEVSSQCPSASGSSGSDSSCVSGQALGRGLEDLSCV
Download sequence
Identical sequences ENSPANP00000015474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]