SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015952 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015952
Domain Number 1 Region: 39-261
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-60
Family DBL homology domain (DH-domain) 0.0000164
Further Details:      
 
Domain Number 2 Region: 247-393
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 507-638
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-31
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 410-522
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-26
Family DEP domain 0.0037
Further Details:      
 
Domain Number 5 Region: 621-705
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000812
Family PDZ domain 0.026
Further Details:      
 
Domain Number 6 Region: 709-773
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000024
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015952   Gene: ENSPANG00000020461   Transcript: ENSPANT00000006726
Sequence length 1658
Comment pep:known_by_projection chromosome:PapAnu2.0:10:15372042:15574247:1 gene:ENSPANG00000020461 transcript:ENSPANT00000006726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPSGSEPGGDGAGDCAHPDPRTPGAAAPSSGPGPCSAARESERQLRLRLCVLNEILGT
ERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKILFSNIEDILEVHKDFLAALEYC
LHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGG
RKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINET
KRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVY
CKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWK
IHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMM
MNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVS
DKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYK
SVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEE
MEGTSSKNKQLRNDFKLVENILAKRLLVGAQEEDYGFDIEEKNKAVVVKTVQRGSLAEVA
GLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLC
FQIHGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLDHFQAFRSRHEE
ALGLYQWIYHTHEDAQEARASQEAASEDPSGEQAQEEDQPDSAMPALLSLGPRLSLCEDS
PMVSLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAADDSVFVE
NCRRLMALSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEP
HPLCGLDFCPTNCHINLMEVSYPKTTSSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQ
HCITTMAAPSWKCLPAEEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAY
LQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRS
DHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMG
SGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQE
FKQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTGNAL
AWSPSKIYLKLASSSCVQGTSLRALEPGVLSCGTAQAWQREGKRKREEVVENLGDLLYPS
LLSRNSQKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVIFY
LDSYHFSKLPSRLEGGASLRLHTALFTKALENVEGLPSPGSQAAEDLQQEINAQSLEKVQ
QYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGAAGSVGA
GLIPISSELCYRLGACQMVMCGTGMQSRSTLSVSLEQAAILARSHGLLPKCIMQATDIMR
KQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences ENSPANP00000015952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]