SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017402 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017402
Domain Number 1 Region: 538-1017
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-137
Family Ras GEF 0.0000000000000117
Further Details:      
 
Domain Number 2 Region: 2-148
Classification Level Classification E-value
Superfamily Histone-fold 3.77e-50
Family TBP-associated factors, TAFs 0.000000325
Further Details:      
 
Domain Number 3 Region: 169-371
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-43
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 4 Region: 389-544
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-39
Family Pleckstrin-homology domain (PH domain) 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017402   Gene: ENSPANG00000016917   Transcript: ENSPANT00000029071
Sequence length 1307
Comment pep:known_by_projection chromosome:PapAnu2.0:13:37962499:38046837:-1 gene:ENSPANG00000016917 transcript:ENSPANT00000029071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIAD
AQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYV
RNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFM
AEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTVEM
TDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGE
GFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEK
ICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGT
LTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNE
YKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRL
PSADVYRFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLT
TYRSFCKPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRV
LNVCRHWVEHHFYDFERDAYLLQRMEEFIGTVRGSKAMKKWVESITKIIQRKKIARDNGP
GHNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSV
WTKEDKEINSPNLLKMIRHTTNLTLWFENPRCIVETENLEERVAVVSRIIEILQVFQELN
NFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPC
VPFFGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESD
IKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPR
PGTMRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFD
SDHSSPFHSSNDTVFIQVTLPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPAES
SPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVF
SSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHS
IAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences ENSPANP00000017402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]