SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017522 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017522
Domain Number 1 Region: 324-569
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-89
Family Eukaryotic proteases 0.0000366
Further Details:      
 
Domain Number 2 Region: 234-330
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-18
Family Hepsin, N-terminal domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017522
Domain Number - Region: 213-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000114
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017522   Gene: ENSPANG00000015323   Transcript: ENSPANT00000015377
Sequence length 577
Comment pep:known_by_projection chromosome:PapAnu2.0:14:107250755:107270274:-1 gene:ENSPANG00000015323 transcript:ENSPANT00000015377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GELAGEQPEGYSSICFQNASPVRTPSAGASPAQASPAGTPPGRASPAQASPAGTPPGRAS
PAQASPARASPAQASPAQAPPVRASLAQVSPVRASPARASPARSSPSRSSSGRSSSARSA
SVTTSPTRVYLVRATPVGAVPIRSSPARSAPAARATRESPGTSLPKFTWREGQKRLPLIG
CVLLLIALVVSLIILFQFWRGHTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFD
WDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAYRTTEVAHRDFANSFSISR
YNSTIQESLHRSECPSQRYISLQCSHCGLRAMTGRIVGGALASESKWPWQVSLHFGTTHI
CGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAVSIAEIIINSNYTDEE
DDYDIALMRLSKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREV
QVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTS
WGTGCGQRNKPGVYTKVTEVLPWIYSKMESEVRFGKS
Download sequence
Identical sequences ENSPANP00000017522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]