SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017551 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017551
Domain Number 1 Region: 357-741
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.89e-78
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0015
Further Details:      
 
Domain Number 2 Region: 42-346
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.7e-50
Family Lipovitellin-phosvitin complex, superhelical domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017551   Gene: ENSPANG00000015810   Transcript: ENSPANT00000001520
Sequence length 3917
Comment pep:known_by_projection chromosome:PapAnu2.0:13:20036432:20070748:-1 gene:ENSPANG00000015810 transcript:ENSPANT00000001520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGMGVQVTQTLKLEDTPKINSRFFGEGTKKVGLAFESTKSTSPPKQAEAVLKTLQELKK
LTISEQNIQRANLFHKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHI
LQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMAREQRSRATLYALSHAVNNYHK
TNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCV
QSTKPSLMIQKAAIQALRKMEPKDEDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADI
NKIVQLLPREQNEQVKNFVASHIANILNSEELDIQDLKKLAKEALKESQLPTVMDFRKFS
RNYRFSKSVSLPSLDPASAKIEGNLIFDPNNYLPKETMLKTTLTAFGFASADLFEIGLEG
KGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKEDKREQDMVNGM
MFTVQKLIEDLKSKEVPEARAYLRILGEELGFARLHDLQLLGKLLLMGARTLQGIPQMIG
EVIRKGSKNDFFLHYIFIENAFELPTGAGLQLQISSSGVTAPGIKAGVKLEVANMQAELV
AKPSVSVEFVTNMGIIIPDFARSGVQMNTNLFHESGLEARVALKAGQLKFIIPSPKRPVK
LLSGSNTLHLVSTTKTEVIPPLIENRQSLSVCKQLFTGLNYCTSSAYSNASSTDSAPYYP
LTGDTRLELELRPTGEVEQYSVSATYELQREDRALVDTLKFVTQAEGVKQTEATMTFKYN
RQSMTLSSEVQIPDFDVDLGTILRVNDESTEGRKSYRLTLDIQNKKITEVTLMGHLSCDT
KEEGKIKGVISVPRLQAEARSEIIAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKI
EFEWNTGTNVDTKKMTSNFPVDLSEYPRSLHMYADRLLDHRVPQTDMTFRHVGSKLIVAM
NSWLQKASGNLPYTQTLQDHLNSLKELNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSL
KVEIPLPFGGKSSRDLKMLETVRTPALHFTSVDFHLPSREFQVPTFTIPKLYQLQVPLLG
VLDLSANVYSNLYNWSASYTGGNTSTDHFSLQARYHMKADSVVDLLSYNVQGSGEATYDH
KNTFTLSCGGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSK
KEQHLFVKEVKIDGQFRVSSFYAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQIT
GRYEDGTLSLISTSDLQSGIIKNTASLKYENYELTLKSDTNGKYENFATSNKMDMTFSKQ
NALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGVST
SATTNLKYSPLVLENELNAEIGLPGASMKLTTNGRFREHNAKFSLDGKAALTELSLGSAY
QAMILGVDSKNIFNFKISQEGLKLSNDMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIY
SSDKFYKQTFNLQLQPYSLVTTLNNDLKYNALDLTNNGKLRLEPLKLHMAGNLKGAYQNN
EIKHIYTISSAALSASYKADTVAKVQGVEFSHRLNTDIAGLASAIDISTNYNSDSLHFSN
VFHSVMAPFTMTIDTHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHL
MSRKSISTSLEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYNTKDKIGVELSGRAL
ADLTLLDYPIEVPLLLSEPVNVIDALEMRDAVEKPQEFTIVAFVKYDKNQDVHTINLPFF
ETLQEYFERNQRTIIVVLENMQRHLKRTNIDQFVRKYRAALGKLPQQANDYLNSFNWERQ
VSRAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDNYDLHDL
KIAIANIIDQIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKIGSSTASWIQNVDT
KYQIRIRIQEKLQQLKRHIQNIDIQHLAGKLKQHVEAIDVRVLLDQLGTTISFERINDVL
EYVKHFVINLIGDFEVAEKINAFRAKVHELIERYEVDQQIQVLMDKLVELAHQYKLKETI
QKLSNVLQQVKIKDYFEKLVGFIDDAVKHLDELSFKTFIEDVNKFLDMLIKKLKSFDYHQ
FVDETNNKIRELTQRLNGEIQALELPQKAEALKLFLQETKATVAMYLESLQDTKITLIID
WLQDALSSASLAHMKAKFRETLEDTRDRIYQMDIEQELQRYLSLVGQVYSTLVTYISDWW
TLAAKNLTDFAEQYSIQDWAKHVKALVEQGFTVPEIKTILGTMPAFEVSLQALQKATFQT
PDFIVPLTDLRIPSVQINFKELKDIKIPSRFSTPEFTILNTFHIPSFTIDFVEIKVKIIR
TIDQMLNSELQWPVPEVYLRDLKVEDIPLARITLPDFHLPEIAIPEFVIPNLNLNDFQVP
DLHIPEFQLPHISHTIEVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASIT
AKGESKLEVLNFDFQANAQLSNPKINPLALKEFVKFSSKYLRTEHGSEMLFFGNAIEGKS
NTVASLHTEKNTLELSNEVIVKINNQLTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLL
EAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTIEGPLTSFGLSNKINSKHLRVNQNL
VYESGSLNFSKLEIQSQVDSQHVGHSVLTAKGTALFGEGKAEFTGRHDAHLNGKVIGTLK
NSLFFSAQPFEITTSTNNEGNLKVSFPLRLTGKIDFLNNYALFLSPSAQQASWQVSTRFN
QYKYNQNFSAGNNKNIMEAHIGINGEANLDFLNIPLTIPEMPLPYTTITTPPLKDFSLWE
KTGLKEFLKTTKQSFDLSVKAQYKKNIHRHSITNPLAVLYEFTSQNIKSFDKHFEKARNN
ALGFVTKSYNDAKIKFDKYKAEKSHDELPRTFQIPGYTVPVVNVEVSPFTVEMSAFGYGI
PKAVSMPSFTILGSNIRVPSYTLILPSLELPVLQVPRNLKLSLPDFKELCTISHIFIPAM
GNITFDFSFKSSVISLNTNAEVFNQSDIVAHLLSSSSSVIEVLQYKLEGTTRLTRKRGLK
LATALSLSNKFVEGSHNSTVSLTKKNMEASVATTAKVQIPILRINFRQELNGNTKSKPTV
SSSMEFKYDFNSSMLYSTAKGAVDHKLILESLTSYFSIESSTKGDVKGSVLSRDYSGTIA
SEANTYLNSKSTRSSVKLQGTSKIDDIWNLDIKENFAGEATLQRIYSLWEHSMKNHLKLE
GLFFTNGEHTSKATLELSPWEMSAFVQVHASQPNSFLDIPHLGQEVALNANTKNQKIRWK
NEVRVHSGSFQNHVELSNDQEKAHLDIAGSLEGHLRFLKNIILPVYGKSLWDFLKLDVTT
SIGRRQHLRVSTAFVYTKNPDGYSFSIPVKVLADVFIIPGLKLNDLNSVLVMPTFHVPFT
DLQVPSYKLDFREIKIYKKLRTSSFALNLPALPEVKFPEVDVLTKYSQPEDSLIPFFEIT
VPESQLTVSQFTLPKSVSVGSAVLDLNAVANKIADFELPTIIMPEQTIEIPSIKFSVPAG
IFIPSFQALTARFEVDSPLYNATWSASLKNKADHVETVLDSTCSSTMQFLEYKLNVVGTH
RIEDGMLASKTKGTFAHHDFSAEYEEDGKYKGLREWERKVHLDIKSPAFTDLHLRYQKDK
KGVSTSAASPAIGTMGMDVDFSKWNIYYSPQSSPDKKLTIFKTELRFRESDEEIQIKVNW
EEEAASGLLTSLKDNVPKATGALYDYVNKYHWEHTGLTLREASSKLRRNLQNNAEWVYQG
AIRQIDDIDLRFQKAASGTTGTYQEWKDKAQNLYQELLTQEGQTSFQGLKDKIPVPGETW
DIHWRGTLHYVLKGGNG
Download sequence
Identical sequences ENSPANP00000017551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]