SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017776 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017776
Domain Number 1 Region: 207-435
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-60
Family DBL homology domain (DH-domain) 0.000000642
Further Details:      
 
Domain Number 2 Region: 436-570
Classification Level Classification E-value
Superfamily PH domain-like 2e-38
Family Pleckstrin-homology domain (PH domain) 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017776   Gene: ENSPANG00000011864   Transcript: ENSPANT00000000424
Sequence length 723
Comment pep:known_by_projection chromosome:PapAnu2.0:19:36085514:36099424:1 gene:ENSPANG00000011864 transcript:ENSPANT00000000424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGTTDRKGGLGMPS
RDRNVGASGQDTPGVSLHPLSLDSPDREPGADAPLELGDLSPQGPMSLEPPAPPESTDEG
AETERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPSSATAVLGP
ARRATPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEA
AHVRMLRVLHDLFFQPMADGLFFSLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLI
EEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQEAESRPRC
RRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDM
EDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVL
LLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLF
TWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSE
NGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFPVEEDNGAGP
PRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVSQP
GCT
Download sequence
Identical sequences ENSPANP00000017776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]