SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018153 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018153
Domain Number 1 Region: 534-746
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-51
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 227-351
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-37
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 871-1024
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 731-856
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-29
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.2e-27
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 6 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-21
Family First domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018153   Gene: ENSPANG00000019972   Transcript: ENSPANT00000012589
Sequence length 1054
Comment pep:known_by_projection chromosome:PapAnu2.0:12:103148487:103290585:1 gene:ENSPANG00000019972 transcript:ENSPANT00000012589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGTRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTVEIFDT
EPKCDGQILLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDEMLD
REHLKANEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSILTGVQFQCFKESGFA
CSLFCRRHSKTHMSIRALTADLPKQSISFPEGLRTPASPSSANTSFYSLSPSTLVPPGLP
EFKDSSSSLTEPQVSYIKSPAAERSSGAVAGGPDTPSAQPVGPPALQPGPGLSTKSPQPS
PSSRNSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDYEEPRHKRMPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEAPSKAHTKGGHQRIGDILLRNMLQLKEFTSYFQRHDEVLTELEKATKRFKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYTPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLRGMLVEESESEWSVPHCFTIYTAQKTIMVAASTRLEK
EKWMLDLNNAIQAAKSGGDTAPALPGSTVCTHPPRSPNEVSLEQESEDDARGARSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPQEADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSARRAPSIVQDGPQPSSGLEGMVRGKEE
Download sequence
Identical sequences ENSPANP00000018153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]