SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019417 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019417
Domain Number 1 Region: 155-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-56
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 342-474
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-31
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 452-493,531-595
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.41e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 618-714
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-21
Family Pleckstrin-homology domain (PH domain) 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019417   Gene: ENSPANG00000024695   Transcript: ENSPANT00000024468
Sequence length 737
Comment pep:known_by_projection chromosome:PapAnu2.0:15:102235808:102292898:1 gene:ENSPANG00000024695 transcript:ENSPANT00000024468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGRGSSTPPGPIAALGVPDTGPGSSSLGKLQVLPVGPRAHCGDPGSPAAAGDGSLDTG
PTGEQSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHPEMTLDSQVPKV
TPQEEADSDVGEEPDPENTPQKADEDAGLAQHSGPQKLLHIAQELLHTEETYVRRLHLLD
QVFCTRLTDAGIPPEVITGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVIHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPEDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTAQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGKKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPLESVVTTEGGSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRECFLSQPVAPESPSPEAPA
EPKQSTEKTPAADPQPSLLCGPLQLSDSGETWSEVWAAIPTSDPQVLHVQGGSQDGRLPR
TIPLPGCKLSVPDPEERLDSGHVWKLQWAKQSWYLSAPSAELQQRWLETLSTAARGDTAQ
DSPGTLQPQVPMGTAAP
Download sequence
Identical sequences A0A096P242
ENSPANP00000019417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]