SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019841 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019841
Domain Number 1 Region: 155-368
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-54
Family DBL homology domain (DH-domain) 0.0000757
Further Details:      
 
Domain Number 2 Region: 382-501
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-19
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019841   Gene: ENSPANG00000023439   Transcript: ENSPANT00000021812
Sequence length 535
Comment pep:known_by_projection chromosome:PapAnu2.0:9:5613703:5658731:1 gene:ENSPANG00000023439 transcript:ENSPANT00000021812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPELAAQKQPRPRRRSRRASGLSTEGVAGPSADTSGPELDDDRYSLRRGSSFTFLTPGP
NWDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLASLISPVRNGAVRRFGQT
IQSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIKRQEAI
YEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEA
TKPDGTVEQIGHILVNWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFS
RKLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAISIIQGVLSDINLKKGE
SECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRN
ERHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAAKNIFRIRLHDPSPGQS
HTLQANDVFHKQQWFNCIRAVAEDSKSLKTHQTQPGIRRARDKARSGGKRKETLV
Download sequence
Identical sequences ENSPANP00000019841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]