SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020836 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020836
Domain Number 1 Region: 775-978
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-47
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 1012-1209
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-45
Family BAR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1506-1574
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-17
Family SH3-domain 0.0000162
Further Details:      
 
Domain Number 4 Region: 244-307
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-17
Family SH3-domain 0.00095
Further Details:      
 
Domain Number 5 Region: 1277-1354
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-16
Family SH3-domain 0.00000745
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 7 Region: 4-63
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000774
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 68-135
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000158
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020836   Gene: ENSPANG00000021232   Transcript: ENSPANT00000016179
Sequence length 1577
Comment pep:known_by_projection chromosome:PapAnu2.0:9:91626764:91747702:-1 gene:ENSPANG00000021232 transcript:ENSPANT00000016179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCICEFTSQELDSLPLHRGDLVILDGVPTAGWLQGRSCWGARGFFPSSC
VRELCLSSQSRQWHSQSALFQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNPDDCIVNGEVDTPVGEEETGPDED
EEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLH
PDTRVEETMTLPQEGNLSRILETSLDCLENSLGVEEQRHETSDHEAEEPDCIISEAPTSP
LGHLTSEYEADRNSYQDEGTAAGPRRSPGVEWEMPLATDSPTSDPTEVVNGISSQPQVPF
HPSLQRSQYYSTAGGSHPHSEQHPDHLPLEARSRDYASLPPKRMYSQLKTLQKPVLPLYR
GSSLSASGVVKPSQSSPQLHDIASYAKKHHTSSVYSVSERSEMKPGLQAQGLVMEAATHS
QGDGSTDLDSKLTQQLIEFEKSLAGPGTESDKILRHFSITDFNSEKDIVRGSSKLITEQE
LPERRKALRPPPPRPCTPVSTYPHLLVDQNLKPAPPLVVRPSRPAPLPPSAQQRTNAVSP
KLLSRHHPTCETLEKEGHGHMGRSLDQTSPCPLVLVRIEEMEQDLDMYSRAQEELNLMLE
EKQDESSRAETLEDLKFCESNIESLNMELQQLREMTLLSSQSSSLVAPSGSVSTENPEQR
MLEKRAKVVEELLQTERDYIRDLEMCIERIMVPLQQAQVPNIDFEGLFGNMQMVIKVSKQ
LLAALEISDAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADL
KSRYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEI
NVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKD
EVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCMERGHRDLEQF
ERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEK
LKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQ
LKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTVDRQSAR
KSLVGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDP
MGSQNRWLIDNGVTKGFVYSSFLKPYNSRRSHSDASVGSHSSTESEHGSSSPRFPRQNSG
STLTFNPSSMAVSFTSGSCQKQPQDVSSPLKEGDQGTLSASLNPGSSESGPSGCPSEPDS
TSQPRSGDAADVARDVNQPTATPRSYRNFRHPEMIGYSVPGRNGQGQDLVKGCARTAQAP
EDRSAEPESSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVN
GKKGYVPSNYIRKTEYT
Download sequence
Identical sequences A0A2I3LQZ0
ENSPANP00000020836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]