SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386019477|ref|YP_005937501.1| from Pseudomonas stutzeri DSM 4166

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386019477|ref|YP_005937501.1|
Domain Number 1 Region: 7-178
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.47e-34
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386019477|ref|YP_005937501.1|
Sequence length 183
Comment cytochrome b561 [Pseudomonas stutzeri DSM 4166]
Sequence
MSVTTPLPRYGRLSIALHWLMLLLIAAVYATIELKGNFAKGSEPRELLKHWHFMLGMTVF
ALVWLRLIARWLHPAPRSLAGAGWEQALAKLMHLALYALMIGLPLLGWLTLSAAGKPIPF
FGLELPALIGADKALAGDFKELHETLAVAGYWLIGLHAAAALFHQYVRRDGTLLRMLPQR
HQA
Download sequence
Identical sequences A0A137XY90 A0A1G3DJZ3 F2MWW4
WP_014595849.1.11668 WP_014595849.1.45895 WP_014595849.1.55002 WP_014595849.1.56336 WP_014595849.1.88125 WP_014595849.1.90639 WP_014595849.1.9384 WP_014595849.1.98540 gi|386019477|ref|YP_005937501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]