SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386022664|ref|YP_005940689.1| from Pseudomonas stutzeri DSM 4166

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386022664|ref|YP_005940689.1|
Domain Number 1 Region: 4-181
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.28e-40
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386022664|ref|YP_005940689.1|
Sequence length 184
Comment cytochrome b561 [Pseudomonas stutzeri DSM 4166]
Sequence
MHWRNSPTHYGLTSIVLHWLVAVAVFGLFALGFWMVGLNYYSSWYRTAPDLHKSIGILLL
LVMLLRVLWRFVSPAPAPLASQGRLTRTAARLGHGLLYLGLFVVMVSGYLISTADGRAIS
VFGLFEVPALITSIPNQADSAGLVHEYAAWALVIFAVVHALAALKHHFIDRDATLMRMLG
RSTD
Download sequence
Identical sequences A4VRG4 F2N685 F8H449 S6L5B3
gi|339495980|ref|YP_004716273.1| WP_011914948.1.31855 WP_011914948.1.43901 WP_011914948.1.45895 WP_011914948.1.55002 WP_011914948.1.62806 WP_011914948.1.85630 WP_011914948.1.90639 WP_011914948.1.9384 gi|386022664|ref|YP_005940689.1| gi|146284254|ref|YP_001174407.1| 379731.PST_3942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]