SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386022360|ref|YP_005940385.1| from Pseudomonas stutzeri DSM 4166

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386022360|ref|YP_005940385.1|
Domain Number 1 Region: 24-497
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.17e-122
Family Pyridoxal-dependent decarboxylase 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386022360|ref|YP_005940385.1|
Sequence length 508
Comment tyrosine decarboxylase [Pseudomonas stutzeri DSM 4166]
Sequence
MTPSSTVVPFAPGPASNGLFTRSNHDDYRRLLQQGLNLVQQCLQRQQQPFSGILPQELAA
DFERVDLERPLGDAGAALRELDQLYLRDAVYFHHPRYVAHLNCPVVLPALLAEVLVSSLN
SSLDTWDQSAGGTLIEQRLIDWTCARIGLGSQADGVFTSGGTQSNLMGLLLAREHVCNRL
PGHGGNLQHGLPPDAGRLRIFASRASHFSVQKSAALLGLGYDAVRSIETDSAQCMSVPAL
AQALADCQRLGELPMAVVATAGTTDFGSIDPLPEIAALCQHYGVWLHVDAAYGGGLLVAP
RYRHWLAGIEHADSVTVDYHKSFFQPVSCSGFFVRQRQHLSYITHHADYLNPRSQTREGT
PNLVNKSIQTTRRFDALKLWLTLRILGAEHIGAMFEEVIDRAADTYRLLADDPAFEVFTP
RLSTLVFRFVAAGVADERLNEINREIRKAIFRSGAAVIAATVVKGRQYLKFTLLNPETTL
DDLRAIVELIRDHGARLLDDRQPVGDRS
Download sequence
Identical sequences F2N1C0
gi|386022360|ref|YP_005940385.1| WP_014597780.1.45895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]