SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331703137|ref|YP_004399824.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703137|ref|YP_004399824.1|
Domain Number 1 Region: 492-566
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 8.5e-16
Family Glucose permease domain IIB 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|331703137|ref|YP_004399824.1|
Sequence length 567
Comment PTS system N acetylglucosamine specific transporter subunit IIBC [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MHFLKTKDKQNKENSFYNNLLNALQRLGKTLMFPIAVLPIAALLARFGALIQDPLANGGL
NISEIQKFIGLIIATPGQIVFDNLAIIFAIGISFGLAKDNRGEAALVGGIVWFGMTALLK
EGLFPTFIWKNVLTSDKLLIERNGQMVHATQLLYFLKGNSVKYQLDSGVVGGIVVGCLVA
LIYNKYKEVTLPQALSFFGGRRFIPLLGVLMIIPLGLGFAIIWPWLQFGLIKIGTALSQA
NGFYKGFAVGTYGFLNRLVYPFGLHHILNTFVWFQLPIEGKLLVDNSTTIINGDIPAFQK
GLIGSGLFTTGFFPLFLGGLPGVALALILVSDKDKKRQMIAFYGGAAFVAFITGIDEPLT
FNFIFISPILYFLNALFTGIFYMFVTWSQISLGIGFSAGFIDYVVSFWTSWQISTKIGWY
ANPLWIWVYALGMFATYFITFYFLIKKLNILTPGRENQLEIQKQTIQKVNQKQIIENTIT
NDSNINKYELMAQKILEIVGKDNIEVVDSCSTRLRLTVKNNSKAVIDDQKIKQIGAFGVV
RLGKNNYQIIIGTDVEHVADKLKEILN
Download sequence
Identical sequences F4MP13
WP_013729273.1.3902 gi|331703137|ref|YP_004399824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]