SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331703282|ref|YP_004399969.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703282|ref|YP_004399969.1|
Domain Number 1 Region: 3-206
Classification Level Classification E-value
Superfamily DhaL-like 5.49e-57
Family DhaL-like 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331703282|ref|YP_004399969.1|
Sequence length 208
Comment glycerone kinase [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MSLKIEAVKQILLKIAEVIDNNKEELTKLDQIIGDGDHGHNLSRGFLKVKEDLENNSYTD
ISSMFKKVGMVLVSNVGGASGPLYGTAFLKASMSLNDKTEMNIDDFSVCLNDAVSGIKLR
GKANIGDKTMVDVLEPVSDLIKELISKNENAKEILNKAVQLAYLKVEETKNIIAKKGRAS
YLGQRSVGHIDPGSYSSYLILKCISENI
Download sequence
Identical sequences F4MPF8
gi|331703282|ref|YP_004399969.1| WP_013729409.1.3902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]