SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331703480|ref|YP_004400167.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703480|ref|YP_004400167.1|
Domain Number 1 Region: 4-194
Classification Level Classification E-value
Superfamily DhaL-like 2.62e-41
Family DhaL-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331703480|ref|YP_004400167.1|
Sequence length 547
Comment dihydroxyacetone related kinase [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MKKLELLKNMITSGVNNLYNHYPQIDKLNVFPVPDGDTGTNMNLTATNGYNEVIDVEYES
IGKFLSAFSRGLIMGARGNSGVIFSQIIKGLSLGMNNAKELSVSEWKSGFSKASEIAYKA
VMKPVEGTILTVIRETSEKVSQLADDTDIKDFWKQVVKNANQSLENTPNLLPLLKEVGVV
DSGGYGLVKFLEGIEYYVLNDQIVNKLDKLEVNNGGNIDMQIEEEFGYCTEAIVMLNDDW
INKLQNSVIRDQLQIFGNTSIVVVVDNDILKVHTHSLSPGQVLQFLQQYGDFQTLKIENM
NLQANKQVKNKDQKWKENSDIKTERKLINETAIISVVSSEKQKRYFEDELGIAFAINAGA
KMNPSTEDFLQAIETVDAKTVFLLPNSSNVYLTAKQAEKIENKSKIYVIQTKTIQQGMVA
ALSFDPSLTASKNYSYLSKSFRNVVSFNITKAEKNTTYNGIEIQKDNLLAIVDNNIIGAE
QTLEAIFDKQLSKYIKSKTEIITIFVGGETNEQDLVQLRKFLDEGYDVEYEIVDGGQETY
NLLIAIE
Download sequence
Identical sequences A0A014M0G4 F4MQ06
gi|331703480|ref|YP_004400167.1| WP_013729585.1.29233 WP_013729585.1.3902 WP_013729585.1.51242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]