SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331703547|ref|YP_004400234.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703547|ref|YP_004400234.1|
Domain Number 1 Region: 3-233
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.78e-67
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000407
Further Details:      
 
Domain Number 2 Region: 240-354
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.59e-20
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331703547|ref|YP_004400234.1|
Sequence length 407
Comment DNA polymerase IV [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MFNKTIIHIDMDAFFASCMQLKHPELKNKPIVISNSFDKSIISTASYEARKYNIKAAMPL
FKAKKLYPQIISVKPDMIFINNISYQIWEFIKNNYTNKIEVASIDEAYLDVSDLVKNTNV
LVLAKNIQKDIYDQFNLTCSIGIGFNRFSAKMSTSLHKPNGITLTTTSNFKDNIWPISIN
KMYGFGQSAAKLLNNTKIKTIKDLALLSDVEVYQLLNKKGLALKNEALGLGSDYINYLSN
DYKSISKETTLNTPIYQYDEIETIILNLSKFISYKLHKNQLLCKTIEIKIRYKIDEKLFD
KQKHLASRHKQITLKNHTNDFEKIYNSALDCFYSLYDQNKGILLVGVGVSKLIHKNQNWV
QLDIENQTKVDKNQIDNALKIENMIFDINKKFKKPVILKAKDLKKSS
Download sequence
Identical sequences F4MQ73
WP_013729650.1.3902 gi|331703547|ref|YP_004400234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]