SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331703802|ref|YP_004400489.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703802|ref|YP_004400489.1|
Domain Number 1 Region: 178-707
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.8e-169
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000326
Further Details:      
 
Domain Number 2 Region: 18-177
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 8.63e-61
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331703802|ref|YP_004400489.1|
Sequence length 723
Comment ribonucleoside diphosphate reductase subunit alpha [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MAIMKENKNTIVLDDVDDEYIKLNARSKIFSKDQDNFQLDVKAAELYLKNYIEPRMKKFS
SLKERLDYLLENQYYDSEIVNKYSFDQISQLNDYAYSFNHHFPSFMGALKFFNAYGLKTF
DTTMYLETYTDRVLMNALFLGNGNFTKAKNLLKDMMLGRFQPATPTFLNAAKKHRGEYVS
CYLLRTEDNMESICRTISTSLQLSKRGGGVAICLTNLRETGSPIKNISGLSSGPIPVMKI
LEDSFTYADQLGQRQGAGAVYISAHHPDIISVLDTKRENADEKIRIKSLSLGLVIPDITF
ELARDNKDMALFSPYDVQKVYNKPLSDISITEKYYEILENPNIKKTYISARKFFLTVAEL
HFESGYPYILFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTASEYSSDLSFIKTGEDICC
NLGSLNIDKMMKSGKEFSDSIYNAISALDIVSRNSDLSAAPSIQKGNAQNHAVGLGAMNL
HGFLATNKIMYDSPEAVDFTNMFFYTVAYNAFKASNKLAQEFEKFASFDESRFADGSWFD
KYTKCEFDKWTPQTNRVKELFKDYDVQIPSQTDWIKLVEEIKKTGLANSHLMAVAPTGSI
SYLSSCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAMGAYELGPDPIINIVA
AAQQHVDQAISLTLFMTDKATTRDLNKAYVNAFKQGCSSIYYVRIRQDVLENSENYECDA
CKI
Download sequence
Identical sequences F4MQX8
WP_013729880.1.3902 gi|331703802|ref|YP_004400489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]