SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331703912|ref|YP_004400599.1| from Mycoplasma mycoides subsp. capri LC str. 95010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331703912|ref|YP_004400599.1|
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.31e-37
Family Isochorismatase-like hydrolases 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331703912|ref|YP_004400599.1|
Sequence length 166
Comment Pyrazinamidase/nicotinamidase [Mycoplasma mycoides subsp. capri LC str. 95010]
Sequence
MKSKNKNKALIIVDYQYDFCDPNGSLYVKNAYTLKPKIEKLAKELKSQGWTIIATKDFHP
IDHCSFKIWNKHCVQNTKGSELYFDYSDVDLIIEKGVNKDIESYSGFFDDANNSNGLDEY
LKLKNIDTLKIVGVATEICVKANYDDAIKLGYDVHVDLEYCKGFTD
Download sequence
Identical sequences F4MR88
gi|331703912|ref|YP_004400599.1| WP_013729987.1.3902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]