SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568141054|ref|YP_008933639.1| from Pseudomonas sp. TKP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568141054|ref|YP_008933639.1|
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.58e-111
Family FMN-linked oxidoreductases 0.00000000213
Further Details:      
 
Domain Number 2 Region: 336-526
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.06e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000112
Further Details:      
 
Domain Number 3 Region: 465-523,561-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568141054|ref|YP_008933639.1|
Sequence length 679
Comment 2,4-dienoyl-CoA reductase [Pseudomonas sp. TKP]
Sequence
MTAAAYPHLLAPLDLGFTTLRNRTLMGSMHTGLEEKPGGFERMAAYFAERARGGVGLMVT
GGIGPNDEGGVYAGAAKLTTEQEAQKHRIVTQAVHDAGGKICMQILHAGRYAYSPKQVAP
SAIQAPINPFKPKELDEAGIEKQIQDFVTCSLLAQSAAYDGVEIMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLAVEIVRRVREAVGPNFIIIFRLSMLDLVEGGSTWEEIVQLAKA
IEQAGATLINTGIGWHEARIPTIATKVPRGAFSKVTAKLRGAVQIPLITTNRINTPEIAE
QILAEGDADMVSMARPFLADPELVNKAAAGRADEINTCIGCNQACLDHTFGGKLTTCLVN
PRACYETELNYLPVKQIKKVAVVGAGPAGLAAATVAAERGHQVTLFDSASEIGGQFNIAK
RIPGKEEFFETLRYFKRKLQTTHVEVCLNTRVDVAQLVAGGYDEIILATGIAPRTPAIPG
IDNAKVLSYLDVILERKPVGKRVAVIGAGGIGFDVSEFLVHQGVSTSLDRDAFWKEWGID
TQLQARGGVAGIKPERHAPARDVFLLQRKASKVGDGLGKTTGWIHRTGLKNKQVQMLNSV
EYLKIDDEGLHIRIGAEGEPQLLAVDNIVICAGQDPLRELQDGLVAAGQHVHLIGGADVA
AELDAKRAINQGSRLAAEL
Download sequence
Identical sequences A0A1H3IYP2 V9R049
WP_024076261.1.9252 WP_024076261.1.96783 gi|568141054|ref|YP_008933639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]