SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568142863|ref|YP_008935448.1| from Pseudomonas sp. TKP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568142863|ref|YP_008935448.1|
Domain Number 1 Region: 3-194
Classification Level Classification E-value
Superfamily ITPase-like 3.14e-68
Family ITPase (Ham1) 0.00000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568142863|ref|YP_008935448.1|
Sequence length 197
Comment nucleoside-triphosphate diphosphatase [Pseudomonas sp. TKP]
Sequence
MNLTQLVLASHNAGKLKELQAMLGESVQLRSIGEFSQVEPEETGLSFVENAILKARNAAR
ISGLPALADDSGLAVDFLGGAPGIYSARYADGKGDAANNAKLLDALKEVPDAERGAQFVC
VLALVRHADDPLPILCEGLWHGRILHAASGEHGFGYDPLFWVPERNVSSAELSPADKNQI
SHRARAMALLRQRLGLK
Download sequence
Identical sequences A0A1B3DGH0 A0A1H3KBE7 A0A2G2NZC3 V9R5C4
WP_024077912.1.30104 WP_024077912.1.33002 WP_024077912.1.9252 WP_024077912.1.96783 gi|568142863|ref|YP_008935448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]