SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313668298|ref|YP_004048582.1| from Neisseria lactamica 020-06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313668298|ref|YP_004048582.1|
Domain Number 1 Region: 152-352
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.32e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000846
Further Details:      
 
Domain Number 2 Region: 436-569
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.75e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000728
Further Details:      
 
Domain Number 3 Region: 16-147
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.38e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00028
Further Details:      
 
Domain Number 4 Region: 354-430
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.43e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313668298|ref|YP_004048582.1|
Sequence length 589
Comment sulfite reductase beta subunit [Neisseria lactamica 020-06]
Sequence
MTVQAKTKGMAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDNFQLIRFHGMY
EQDDRDIRAERAEAKLEPLKFMLLRCRLPGGIIKPSQWIELDKFARENSYYRSIRLTNRQ
TFQFHGVPKAKLQTMHRLLHKLGLDSIATAADMNRNVLCTSNPIESELHRQAYEYAKKIS
EHLLPRTRGYLDVWVDGKKVQSSDDFLQEDEPILGKTYLPRKFKTAVVIPPLNDVDCYGN
DLDFVAVSDGNGRLAGFNVLAGGGLSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTT
QRDFGNRSDRKNARTRYTIQNMGLDNFRAEVERRMGMPFEPVRPFKFTGRGDRIGWVKGI
DGNWHLTLFIESGRLVDEGGKQLLTGVLEIAKIHKGDFRITANQNLIVANVAEADKAEIE
ELARTYGLIRNDVSKLRENAMSCVSFPTCPLAMAEAERVLPDFIDELDKIMAKHGTSDDY
IVTRITGCPNGCGRAMLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILSEL
DDLIGKWAAERNIGEGFGDFAIRTGIVKPVLNAPVDFWDASKAVAIARA
Download sequence
Identical sequences E4ZCY1
WP_013448883.1.98800 gi|313668298|ref|YP_004048582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]