SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313668859|ref|YP_004049143.1| from Neisseria lactamica 020-06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313668859|ref|YP_004049143.1|
Domain Number 1 Region: 271-403
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 9.29e-25
Family Cell-division protein ZipA, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313668859|ref|YP_004049143.1|
Sequence length 420
Comment hypothetical protein NLA_15750 [Neisseria lactamica 020-06]
Sequence
MIYIVLFLAAVLAVVAYNMYQENQYRKKVRDQFGHSDKDALLTGKTSHVRDGQPSGSSGV
MQKPQAEVKKPAKPHDPALLSLQEQDALYIAKHKQAAASPFKTKIETVLEEGGTAAPSPA
APQPQIEKPAPQAAPVPQTPAKPLITLQELSKVELPWFDVRFDFISYIALTEAAELHALP
RLSNRHRYQIIGCTTDDHFQVAEPIPGLRYQAFIIGVQAVSRNGLASQEELSAFNRQVDA
FAQSIGGRTLHTDLAAFIEVASALDAFCARVDQTIAIHLVSPTGISGVELRSAVSGVGFT
LGEDGAFHYADESGSTMFSICALNNEPFTNALLDNQSYKGFSMLLDIPHSPAGEKTFDDL
FMDLAVRLSSQLNLNLVNDKMEEVSTQWLKDVRTYVLARQEEMLKVGIRPGSQTALRLFS
Download sequence
Identical sequences E4ZEJ8
WP_013449323.1.98800 gi|313668859|ref|YP_004049143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]