SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312143640|ref|YP_003995086.1| from Halanaerobium hydrogeniformans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312143640|ref|YP_003995086.1|
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily YheA/YmcA-like 5.49e-25
Family YheA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312143640|ref|YP_003995086.1|
Sequence length 114
Comment hypothetical protein Halsa_1305 [Halanaerobium hydrogeniformans]
Sequence
MATVINYAEELADAIVESSEFQELKEKEEIMVGDDEAKSMLDDLNAKYQQVQMMQQNGQE
ISDEKKQELSMMEQKMKQNEKIAEFYEAQNHFNQLMNSVNQVITDKLQNFEEAE
Download sequence
Identical sequences E4RKR2
gi|312143640|ref|YP_003995086.1| WP_013405813.1.59287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]