SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374330422|ref|YP_005080606.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374330422|ref|YP_005080606.1|
Domain Number 1 Region: 18-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.96e-29
Family HxlR-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374330422|ref|YP_005080606.1|
Sequence length 119
Comment HxlR family transcriptional regulator [Pseudovibrio sp. FO-BEG1]
Sequence
MIIAEKTTEPECQPTETEELCPMPDIAQLIGAKWKLIVLQILIFKGTKRFNELRRMIDGV
TQTMLTSQLRALERDGLVSRKIYAEVPPRVEYSATERAIALTDMFHAMHKWWVETGEQK
Download sequence
Identical sequences G8PIN4
WP_014284750.1.37980 gi|374330422|ref|YP_005080606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]