SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374329555|ref|YP_005079739.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374329555|ref|YP_005079739.1|
Domain Number 1 Region: 16-82
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000162
Family SPO1678-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374329555|ref|YP_005079739.1|
Sequence length 124
Comment ISCc3, transposase OrfA [Pseudovibrio sp. FO-BEG1]
Sequence
MGQNTRTASAAAEKAVKDIRRKTRKRYSTEDKIRIVLAGLRGEDSIAELCRQEGISQGLY
YSWSKEFLEAGKKRLAGDTARQASTGEVKVLRKEARDLKEVVAEQALELRLLKKSMLEDG
GDDE
Download sequence
Identical sequences G8PG54
gi|374329526|ref|YP_005079710.1| gi|374329555|ref|YP_005079739.1| gi|374331466|ref|YP_005081650.1| gi|374331705|ref|YP_005081889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]