SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374329670|ref|YP_005079854.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374329670|ref|YP_005079854.1|
Domain Number 1 Region: 92-228
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.71e-29
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-20
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374329670|ref|YP_005079854.1|
Sequence length 254
Comment transcriptional regulatory protein [Pseudovibrio sp. FO-BEG1]
Sequence
MTLDPNRRRYQDVAEELVRDLANGAFAIGDKLPTERKISEDLGVSRSLVRDAMIMLEVQG
LVDVRKGSGTYVLRLPGDVTPDSALETDIGPFELLQARQLLESNIAAFAATMATKADIIQ
MRETLAKERDEIESGSGSHKADEEFHRLVAQASQNSVLTESVEHLWTLRKRSRMWEQLHQ
RIFDRGYQKKWLDDHQAILTALQCRDPQMARQAMWQHLENVRMTLLELSDVDDPSFDAYL
FDTDPLAAVNDLKK
Download sequence
Identical sequences A0A1I7CJK3 G8PP07
WP_014284111.1.37980 WP_014284111.1.38711 gi|374329670|ref|YP_005079854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]