SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374330275|ref|YP_005080459.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374330275|ref|YP_005080459.1|
Domain Number 1 Region: 102-236
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.99e-25
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.21e-20
Family GntR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374330275|ref|YP_005080459.1|
Sequence length 261
Comment GntR family transcriptional regulator [Pseudovibrio sp. FO-BEG1]
Sequence
MVSVDNLFEPIDHDTVVDSVTEQIEGLILAGVLKEGTKLPSERDISERMGVSRPKVREAL
KRLEDSNLITIRHGEGSFIAPLISAAMSPALINLISRNQTAFYDYLEYRRVQEGFAARLA
AERATKLDLERLEAILENLRDAQARADDIASKKNDIAFHLAIVDASHNAMLIHMMSSIYE
LTQKGVFYNREFLRSIDGTGEQLLEQHEEIGRAIFSRNGAKAEEAAHRHIDFVETSFRLG
QDQQRRELISSKLYALQRGEE
Download sequence
Identical sequences A0A1I7D949 B6R2J8 G8PGV7
gi|374330275|ref|YP_005080459.1| WP_008549269.1.27339 WP_008549269.1.37095 WP_008549269.1.37980 WP_008549269.1.38711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]