SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374330364|ref|YP_005080548.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374330364|ref|YP_005080548.1|
Domain Number 1 Region: 52-187
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-21
Family GntR ligand-binding domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000124
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374330364|ref|YP_005080548.1|
Sequence length 194
Comment GntR family transcriptional regulator [Pseudovibrio sp. FO-BEG1]
Sequence
MEPGSKLRIREMCSTFDVGPTPVREALSRLVSQGLVATQSHKGFYIPELSQKEFQDIVEQ
RRLLESATVRTAVEKGDAQWRDRVLDAYHALQEIERTWQASRRDFWNEWEEANRVFHMTL
VEGAGSSWASRFLHMLHDQCTRYRAAMRRAGFISEGVQDDHTQLITAVRTGDGALAEQTI
KAHIDRLPALCMPS
Download sequence
Identical sequences B6R2V1 G8PHT3
WP_008549060.1.37095 WP_008549060.1.37980 WP_008549060.1.38711 gi|374330364|ref|YP_005080548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]