SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374332829|ref|YP_005083013.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374332829|ref|YP_005083013.1|
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily TrpR-like 0.000000000277
Family SPO1678-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374332829|ref|YP_005083013.1|
Sequence length 52
Comment hypothetical protein PSE_4489 [Pseudovibrio sp. FO-BEG1]
Sequence
MVAAVRGGLLSLDEACNRYTLTVEEFLSWQNSIDRHGLAGLRATRVQDYRSN
Download sequence
Identical sequences A0A165QIG3 G8PHC1
gi|374332829|ref|YP_005083013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]