SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374333531|ref|YP_005086659.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374333531|ref|YP_005086659.1|
Domain Number 1 Region: 80-203
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000732
Family GntR ligand-binding domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 24-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000106
Family GntR-like transcriptional regulators 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374333531|ref|YP_005086659.1|
Sequence length 218
Comment GntR family transcriptional regulator [Pseudovibrio sp. FO-BEG1]
Sequence
MSDFQATTQAAFAKAEIERKVIFRELDTEQLYSENKLSAMLQLGRTPVREALQALEQEDM
LKVHARKGVEFLEISAAQQLQLLEIRKEIEPTCIKYAILRGSSEHRVHMLQLAQNILESA
QGDEDASLLEALRGIHFAITNASGNPYFHHALARVQSQSRRFWFANKTRDDTMVCSQFHA
DIMRSVAIGNEIAAKEQLLKLHEYLAGSALKVIKLSAN
Download sequence
Identical sequences G8PVA4
gi|374333531|ref|YP_005086659.1|NC_016646 WP_014290226.1.37980 gi|374333531|ref|YP_005086659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]