SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374333653|ref|YP_005086781.1| from Pseudovibrio sp. FO-BEG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374333653|ref|YP_005086781.1|
Domain Number 1 Region: 9-315
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.92e-29
Family ADP-ribosylglycohydrolase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374333653|ref|YP_005086781.1|
Sequence length 319
Comment ADP-ribosylation/Crystallin J1 [Pseudovibrio sp. FO-BEG1]
Sequence
MSQHAVKAHSLLGAFVADAASLGLHWLYDVERIHHVTQEQHDSAAFVPLTPSYFEGVPAY
FAHANRQDGQFTQYGENLHLALQHLLAHDKHLKMEEFQQAFAAHFGAGGTYNGYIDRPTR
GTLENIASEKLTPSGVDDDQLPALSKIPAVLFAYDQSDQMQDQVEAIIRSTNDNEESVAY
GFVFADLLDRVVNGEELQDALAAATDSSHPDIQGKLKAALEATETDSVSYGETTGRACHL
EMGVPLSFHILKNTASYREAIETNILAGGDSAGRSILIGTVLGAIHGLDADKGIPLSWIL
KVQNNTHLWQECCELTGHS
Download sequence
Identical sequences G8PVM6
gi|374333653|ref|YP_005086781.1| WP_014290342.1.37980 gi|374333653|ref|YP_005086781.1|NC_016646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]