SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312793340|ref|YP_004026263.1| from Caldicellulosiruptor kristjanssonii 177R1B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312793340|ref|YP_004026263.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily RNase III domain-like 4.53e-47
Family RNase III catalytic domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 108-219
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.98e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312793340|ref|YP_004026263.1|
Sequence length 222
Comment ribonuclease iii [Caldicellulosiruptor kristjanssonii I77R1B]
Sequence
MEEIERALGYTFKDKNLLRLALTHKSATHSNKNCYERFEFLGDAALELAVSKYLFVHFPE
LSEGELTNIRAAVVCSQTLSKVAEKLNLKNHIIFGKREKMEKFHENKSILADVLEAIFGA
IFIESGFDIVEKIIVNLLKPYIQKAVAGKLFYDYKTKLQEIVQREGNKKIVYKDCEIIEK
KYFKSELFIEGKKVSEGYGTSKKEAQQDAAYKFLLEMGEQEE
Download sequence
Identical sequences E4S6N5
gi|312793340|ref|YP_004026263.1| WP_013432453.1.61561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]