SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312793922|ref|YP_004026845.1| from Caldicellulosiruptor kristjanssonii 177R1B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312793922|ref|YP_004026845.1|
Domain Number 1 Region: 82-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.32e-29
Family Translational machinery components 0.00023
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.13e-23
Family Ribosomal S5 protein, N-terminal domain 0.0000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312793922|ref|YP_004026845.1|
Sequence length 168
Comment 30S ribosomal protein S5 [Caldicellulosiruptor kristjanssonii I77R1B]
Sequence
MAQKRIDPKGLDLKERVVNINRVAKVVKGGKRLKFSAIVVVGDENGHVGAGHGKAAEIPD
AIRKAIEDAKKHLIEVPIVGTTIPHEAIGDFGASKVLIKPAPEGTGVIAGGAVRAVCELA
GIKDIRTKSLGSNNPANVVHATIEALKQLRRPEEVARIRGKTLEEILK
Download sequence
Identical sequences A0A2G6VBJ4 B9MKG4 E4Q2Z9 E4Q832 E4SAR1 E4SB74
gi|222529713|ref|YP_002573595.1| gi|312622062|ref|YP_004023675.1| gi|312793922|ref|YP_004026845.1| gi|312135479|ref|YP_004002817.1| WP_013402934.1.1144 WP_013402934.1.12921 WP_013402934.1.20482 WP_013402934.1.22435 WP_013402934.1.28668 WP_013402934.1.29544 WP_013402934.1.33084 WP_013402934.1.45436 WP_013402934.1.58293 WP_013402934.1.61561 WP_013402934.1.61668 WP_013402934.1.70627 WP_013402934.1.71443 WP_013402934.1.76028 WP_013402934.1.77617 WP_013402934.1.9959 gi|312127243|ref|YP_003992117.1| 521460.Athe_1728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]