SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317154468|ref|YP_004122516.1| from Desulfovibrio aespoeensis Aspo-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317154468|ref|YP_004122516.1|
Domain Number 1 Region: 223-552
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.59e-89
Family beta-Lactamase/D-ala carboxypeptidase 0.0000671
Further Details:      
 
Domain Number 2 Region: 60-221
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.62e-37
Family Penicillin binding protein dimerisation domain 0.0014
Further Details:      
 
Domain Number 3 Region: 589-638
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000101
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317154468|ref|YP_004122516.1|
Sequence length 652
Comment penicillin-binding protein transpeptidase [Desulfovibrio aespoeensis Aspo-2]
Sequence
MANESQGRKDHSRVKIGLVAALFALAFAGLWVRAGWVQLHMGSALLSQASRQSLASEFEY
GERGRIFDRNGEMLATSVEAKSVYACPFEIADLDKAAGTVAKALGMPLSQIRKKLASKKQ
FIWVKRQISDREAAALTKADIPGIRLASEFSRIYPNGHLAGQTLGFVDIDGHGLEGVERL
FDARMQPGKAKFVVQRDAKGSRLYLDAQGREVNINGLDVRLTLDTHIQHAAEQALANAIE
QYKARAGIVLVVEVESGDILAMANQPFFNPNTVKGSNPTQRRLRAVTDVYEPGSTFKPFL
FAAALEERVIDPETLINCENGRWKVANRTIRDTHPEGWLPAHKVMRYSSNIGTAKIGLDM
GADVYSSYLSKLGFGEKTSLGLSGESSGLVMHPAKWTSVDLAAISFGQAIGVTAVQMARA
FLCLANGGVTRDLNLVRDPDPGRKNAAVRVFSPETAATVLSMMKDVVHEDGTGRNARIPG
ITMAGKTGTAQKAAKGGYGDEYLSSFVALVPADQPKLLVITMIDEPQKANYGSMVAAPVC
RDVTVRTLAYYGKVSENLESVVAETVSVDSLADFPLDQAMADPVEQPETGTVPNIRGLTV
RRALEVLARRGIVPVLKGQGTTIRDQKPGAGQPWPAEQQREGTDDVFILWLS
Download sequence
Identical sequences E6VXF4
gi|317154468|ref|YP_004122516.1| WP_013515676.1.85979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]