SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374325689|ref|YP_005083889.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374325689|ref|YP_005083889.1|
Domain Number 1 Region: 1-353
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 3.66e-121
Family Chorismate synthase, AroC 0.000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374325689|ref|YP_005083889.1|
Sequence length 369
Comment chorismate synthase [Pyrobaculum sp. 1860]
Sequence
MNTFGREFRITTFGESHGRALGVVIDGVPAGLPISEEDIRRELDRRMFCHIHWLNPRCEP
EEFEILSGVKDGHTQGTPIAIVIWNKKAISSYYDELWLKPRPGHADLAYYLKYGKFYDHR
GGGRASGRTTAAVVAAGAVAKKLLAQLGVEVAGHIIELGGVEVKGSYTFDDVKKSWEKPL
PVVDGEALAAMLELLRRAAAEGDSVGGGVEVWAVGVPPGLGEPHFGKIKAELAMAAFSIP
AVVALDWGAGRALAKMKGSEANDPIIVKEGRLALESNKAGGVLGGVTVGEPVYFRVWFKP
TPSVRKPQKTVDLAKMEPTILEFKGRYDVSVVPKALVALEAMAAITLADHALRAGLVRRD
KPLRDPIAR
Download sequence
Identical sequences G7VEL3
gi|374325689|ref|YP_005083889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]