SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374326166|ref|YP_005084366.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374326166|ref|YP_005084366.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily Resolvase-like 1.26e-27
Family gamma,delta resolvase, catalytic domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|374326166|ref|YP_005084366.1|
Domain Number - Region: 209-245
Classification Level Classification E-value
Superfamily YfgJ-like 0.00968
Family YfgJ-like 0.013
Further Details:      
 
Domain Number - Region: 165-208
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0762
Family Tetracyclin repressor-like, N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374326166|ref|YP_005084366.1|
Sequence length 252
Comment resolvase [Pyrobaculum sp. 1860]
Sequence
MIPAVTYIRVSTEEQDPENQRLFLERWAGERGIHIVKHYVDVGVSGATEPWGRPAFREMA
AEVEKLEPRPKVLLVYEISRLVRSFQELFTLLDVVENKLGLVVVSASEREQALQSLDGVY
RQFLRAVLAFVATMEREFIRQRTKTALERARIRGRIWNVAERRGDIAQAVVDMYLSGASL
RETARAFGLSLYEVRRILSAAGVYRPGPYTCPRCFSRLKVVERTAKVANGRYTVVERLYC
PNCGYEESREGS
Download sequence
Identical sequences G7VHU2
gi|374326166|ref|YP_005084366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]