SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374326624|ref|YP_005084824.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374326624|ref|YP_005084824.1|
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 8.64e-69
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000221
Further Details:      
 
Domain Number 2 Region: 221-373
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.29e-49
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374326624|ref|YP_005084824.1|
Sequence length 377
Comment acyl-CoA dehydrogenase [Pyrobaculum sp. 1860]
Sequence
MSAEIQLIRKTVREFVDSAVLPQIKKMEAGEYPRDLVKKLGELGLLAPLVPAEYGGGSAD
TLTQVVIIEELARASPALATIAEIQGSMIAHNIYELGNKRQKEEILPKIAAGDYVAAFAL
SEPCCGSDAAAIETRAEKVGREWVLNGTKMWITSGLHADYYLVFARTGPREARHRAITSF
LIPRSSCIEATPIEVMGMHGSGTAEVKFNNCRAGDDDVVGEVNGGWRVAMNGINLGRLNV
GALGLGIAEESFIQAFKYAKKRVAFGRPISEFQIIQHYLAEMYIKAEAARSVVYTAAKMR
DGGDPQFVLYAQAAKVLGSRAAVENSRLAVQIMGGFGYSKDAHVEMLYRDAKVTEIYEGT
NEIILNTLFKFLDREVG
Download sequence
Identical sequences G7VCF2
gi|374326624|ref|YP_005084824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]