SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374326641|ref|YP_005084841.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374326641|ref|YP_005084841.1|
Domain Number 1 Region: 20-419
Classification Level Classification E-value
Superfamily ADC synthase 3.01e-126
Family ADC synthase 0.0000000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374326641|ref|YP_005084841.1|
Sequence length 422
Comment anthranilate synthase component I [Pyrobaculum sp. 1860]
Sequence
MRKVPLSKLPPPRELAGGLYWDGEEFVALLESGTGYAERSRFSLVAWGISREYVSWGADV
YDVTYRAYRELERFASPFGGDVVIGAVSYDASAYVEPILLRYGKVDRSLPAAFFVKPAGW
VLYDKLLGRAYVHGELPRLGRMGEEPLAVRGPVAGTDEASFKRWVGEARRRIEEGEIFQV
VLSRYLDYAVAGDVFALYTSLASANPSPYMFFVRWRGLHLLGTSPELLVKVQGDRAETHP
IAGTRPRGATEEEDLALEEDMLRDEKELAEHYMLVDLARNDLGRVCRPGTVKVDELFAVE
KYSRVQHIVSRVSCVLERKFSPVDALFATHPAGTVSGAPKVRAMEIIAELEDSPRGFYAG
SLGFFSPSLSEFAIVIRTAILRDGVLRIQAGAGVVYDSTPEREYRETEAKLRALREALGV
WT
Download sequence
Identical sequences G7VCG9
gi|374326641|ref|YP_005084841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]