SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374326935|ref|YP_005085135.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374326935|ref|YP_005085135.1|
Domain Number - Region: 267-311
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00045
Family Tyrosyl-DNA phosphodiesterase TDP1 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374326935|ref|YP_005085135.1|
Sequence length 326
Comment hypothetical protein P186_1460 [Pyrobaculum sp. 1860]
Sequence
MLTDFEALRAYLEARNTAVSSIRDVVETAQKIISGGELSESEKRTADLLWHLGLVLKTPG
GALRPTAQLRTVARGSLDSYSLIARRLARWTPMRILLRYLAAKGGAAGLDDVAEELGAEM
RGVTGKYLPVLKLVNPRLKAPVSKPFNPHVVEAVLFKLGAEVGLLTYDRAHKTASLTELA
EEHMEQQDTEVVRTAPGSPIVLAAVAAAVASANKVHIISPWVDDKVARALDPLLHGRKAV
VISREPHDEPHRRGLEILSKHGEAHCYRHLHTKLVVGISAVVTSANLVYTSMLRNIETGV
YYRDAPPALRLHAEEILASARRCNQS
Download sequence
Identical sequences G7VER7
gi|374326935|ref|YP_005085135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]