SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374327340|ref|YP_005085540.1| from Pyrobaculum sp. 1860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374327340|ref|YP_005085540.1|
Domain Number 1 Region: 12-183
Classification Level Classification E-value
Superfamily Globin-like 7.91e-18
Family Truncated hemoglobin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374327340|ref|YP_005085540.1|
Sequence length 192
Comment protogloblin ApPgb [Pyrobaculum sp. 1860]
Sequence
MREIPGYEFGKVPDAPISDEEFELLKKSVMWTEEDEKYRKLACEVLKGQVEQILDLWYGW
VGSNPHLVYYFGDRSGRPIPQYLEAVRKRFGQWILDTVCRSYDRQWLNYVYEIGLRHHRT
KKGKTDGVETVEHIPLRYMVAFIAPIGLTIKPFLEKGGHPPDVVEKMWAAWIKSVVLQVA
IWSHPYAKPGEW
Download sequence
Identical sequences G7VHJ7
gi|374327340|ref|YP_005085540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]